PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009599646.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 283aa    MW: 31890.6 Da    PI: 7.8604
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009599646.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.2e-151663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W+++Ed++l+d++  +G g+W+++a   g+ R +k+c++rw +yl
   XP_009599646.1 16 RGLWSPDEDQKLKDYILTYGHGCWSSVAISAGLQRNGKSCRLRWINYL 63
                     788*******************************************97 PP

2Myb_DNA-binding52.98.4e-1769114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++t+E++ ++ ++ +lG++ W+ Ia++++ gRt++++k++w++yl
   XP_009599646.1  69 RGTFSTDEEDTILTLHGMLGNK-WSQIAQHLP-GRTDNEIKNHWHSYL 114
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4141163IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-221166IPR009057Homeodomain-like
SuperFamilySSF466895.87E-2914110IPR009057Homeodomain-like
SMARTSM007171.3E-111565IPR001005SANT/Myb domain
PfamPF002491.4E-131663IPR001005SANT/Myb domain
CDDcd001673.84E-101963No hitNo description
PROSITE profilePS5129425.89864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2467118IPR009057Homeodomain-like
SMARTSM007176.6E-1568116IPR001005SANT/Myb domain
PfamPF002492.3E-1569114IPR001005SANT/Myb domain
CDDcd001673.54E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGCKQLVEKP KQKHKRGLWS PDEDQKLKDY ILTYGHGCWS SVAISAGLQR NGKSCRLRWI  60
NYLRPGLKRG TFSTDEEDTI LTLHGMLGNK WSQIAQHLPG RTDNEIKNHW HSYLKKRVAK  120
MAKNESGQAK SGCTGLHIEH RESSPSSIKL ASQNSSPDSL ADSDQSASLL VDFARENCKS  180
NLPSVLFSEW FSVEQFSGQE DFKNTTNQDL SKNNFGCNDS VFPDAFMQYI PIMNEVTYGN  240
GISQGFNSGK VNGFESRFQP PFKFGFEEFI SGEFNTNGDV MYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599646.10.0PREDICTED: transcription factor LAF1-like
TrEMBLM1B4S41e-118M1B4S4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000370801e-117(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.18e-61myb domain protein 19